PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.6G063100.2.p
Common NameLOC101753432, SETIT_014031mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB_related
Protein Properties Length: 337aa    MW: 35756.4 Da    PI: 9.9078
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.6G063100.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding461.2e-14103147347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +WT+eE+  ++ + ++lG+g+W+ Ia+ + ++Rt+ q+ s+ qky
  Seita.6G063100.2.p 103 PWTEEEHRTFLAGLEKLGKGDWRGIAKNFVTTRTPTQVASHAQKY 147
                         8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.96896152IPR017930Myb domain
SuperFamilySSF466891.22E-1797152IPR009057Homeodomain-like
TIGRFAMsTIGR015572.0E-1899151IPR006447Myb domain, plants
SMARTSM007171.4E-11100150IPR001005SANT/Myb domain
CDDcd001672.74E-10103148No hitNo description
Gene3DG3DSA:1.10.10.603.2E-12103146IPR009057Homeodomain-like
PfamPF002491.9E-12103147IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MPQDSRPAGM RLFGVTIAPA PPPAPEADPP DRDPSPNPPV AVREDVMRKC KSMGNLAALG  60
AGADAVGAGA DGVGAGDGYL SDGGLMQSSG KRRRAQERKK AVPWTEEEHR TFLAGLEKLG  120
KGDWRGIAKN FVTTRTPTQV ASHAQKYFLR QTNPNKKKRR SSLFDMMPSE LSPVPNCPIL  180
PSSMAKVHDV VAMTRQLQNS NLEGGSSSNA ANIAPQVGRD LPPVPSFRAT NIDSSVSKLN  240
HMEPLWRTPY PFRPIPRAPD GTSSSTSIAA NIASPDAKAN PTACTSTFLS PRSDTSSVPP  300
KADPPAEMKD LELTVATPSQ QNMTNMSSQN AELAQA*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1155159KKKRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF6794580.0HF679458.1 Saccharum hybrid cultivar Co 86032 mRNA for ScMYB52 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004972855.10.0PREDICTED: uncharacterized protein LOC101753432 isoform X2
TrEMBLK3YIG60.0K3YIG6_SETIT; Uncharacterized protein
STRINGSi014031m0.0(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.12e-39MYB_related family protein